What is the catalog number for Lytic Peptide, SB – 37?

The catalog number for Lytic Peptide, SB – 37 is VAC-00607.

What sizes are available for Lytic Peptide, SB – 37?

Lytic Peptide, SB – 37 is available in the following size(s): 1 mg, 5 mg, 10 mg.

How many pack sizes does Lytic Peptide, SB – 37 come in?

Lytic Peptide, SB – 37 is available in 3 different pack sizes.

Is Lytic Peptide, SB – 37 in stock?

Lytic Peptide, SB – 37 is currently made to order / not held in immediate stock. Contact us for lead time.

Lytic Peptide, SB – 37

Product Specifications

Synonyms

Met-Pro-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu- Ala-Lys-Ala-Leu-Gly; H-MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG-OH

Molecular Formula

C188H320N54O45S

Molecular Weight

4,088.94 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb652727 100 µL

ZAR1 Antibody

Sign In for Pricing

View Details

HY-P87250 1 Each

Steroid sulfatase Antibody (YA6938, Rabbit)

Sign In for Pricing

View Details

13530026 500 ng

BTD Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing

View Details

358373-01 48 Tests

Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing

View Details

358373-02 96 Tests

Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing

View Details

A11873 100 µL

Anti-Semaphorin-4F SEMA4F Antibody

Sign In for Pricing

View Details