What is the catalog number for Lytic Peptide, SB – 37?

The catalog number for Lytic Peptide, SB – 37 is VAC-00607.

What sizes are available for Lytic Peptide, SB – 37?

Lytic Peptide, SB – 37 is available in the following size(s): 1 mg, 5 mg, 10 mg.

How many pack sizes does Lytic Peptide, SB – 37 come in?

Lytic Peptide, SB – 37 is available in 3 different pack sizes.

Is Lytic Peptide, SB – 37 in stock?

Lytic Peptide, SB – 37 is currently made to order / not held in immediate stock. Contact us for lead time.

Lytic Peptide, SB – 37

Product Specifications

Synonyms

Met-Pro-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu- Ala-Lys-Ala-Leu-Gly; H-MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG-OH

Molecular Formula

C188H320N54O45S

Molecular Weight

4,088.94 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LH17630V 100 µg

CLSTN2 (NM_022131) Human Over-expression Lysate

Sign In for Pricing

View Details

E45H40728M5 20 µg

CXCL5 (NM_002994) Human Recombinant Protein

Sign In for Pricing

View Details

MBS8112725-01 0.1 mL

Recombinant Anti-TIMP-1 Antibody, Rabbit Monoclonal

Sign In for Pricing

View Details

MBS8112725-02 5x 0.1 mL

Recombinant Anti-TIMP-1 Antibody, Rabbit Monoclonal

Sign In for Pricing

View Details

orb2594419 100 µg

TLR4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing

View Details

APR25579N-01 50 µL

UQCR10 Rabbit pAb (APR25579N)

Sign In for Pricing

View Details