Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL-37 pentamide

Product Specifications

Synonyms

Leu-Leu-Gly-Asn-Phe-Phe-Arg-Lys-Ser-Lys-Gln-Lys-Ile-Gly-Lys-Gln-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asn-Phe-Phe-Arg-Asn-Leu-Val-Pro- Arg-Thr-Gln-Ser; H-LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS-OH

Molecular Formula

C208H343N65O48

Molecular Weight

4,522.46 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AEC coloring system
CT356 10 Plates

AEC coloring system

Sign In for Pricing
View Details
Active Mucosae Associated Epithelia Chemokine (MEC)
RPU59178-01 50 µg

Active Mucosae Associated Epithelia Chemokine (MEC)

Sign In for Pricing
View Details
Active Mucosae Associated Epithelia Chemokine (MEC)
RPU59178-02 100 µg

Active Mucosae Associated Epithelia Chemokine (MEC)

Sign In for Pricing
View Details
Active Mucosae Associated Epithelia Chemokine (MEC)
RPU59178-03 1 mg

Active Mucosae Associated Epithelia Chemokine (MEC)

Sign In for Pricing
View Details
Bovine S100 Calcium Binding Protein A8 (S100A8) ELISA Kit
orb1656007-01 48 Tests

Bovine S100 Calcium Binding Protein A8 (S100A8) ELISA Kit

Sign In for Pricing
View Details
Bovine S100 Calcium Binding Protein A8 (S100A8) ELISA Kit
orb1656007-02 96 Tests

Bovine S100 Calcium Binding Protein A8 (S100A8) ELISA Kit

Sign In for Pricing
View Details