Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL-37 pentamide

Product Specifications

Synonyms

Leu-Leu-Gly-Asn-Phe-Phe-Arg-Lys-Ser-Lys-Gln-Lys-Ile-Gly-Lys-Gln-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asn-Phe-Phe-Arg-Asn-Leu-Val-Pro- Arg-Thr-Gln-Ser; H-LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS-OH

Molecular Formula

C208H343N65O48

Molecular Weight

4,522.46 g/mol

Controlled

No

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MS4A10 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
30698156 3x 1.0 µg DNA

MS4A10 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Anti-Thrombospondin 2/THBS2 Antibody Picoband® (FITC Conjugate)
A03253-1-FITC 100 µg/Vial

Anti-Thrombospondin 2/THBS2 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
AKAP10 sgRNA CRISPR Lentivector (Human) (Target 1)
K0066402 1.0 µg DNA

AKAP10 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CNPase Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1581923 100 µL

CNPase Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
ZNF446 (NM_017908) Human Over-expression Lysate
LS055663 100 µg

ZNF446 (NM_017908) Human Over-expression Lysate

Sign In for Pricing
View Details
Mmu-miR-3090-5p antagomir
HY-RI02970A-01 5 nmol

Mmu-miR-3090-5p antagomir

Sign In for Pricing
View Details