Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL-37 pentamide

Product Specifications

Synonyms

Leu-Leu-Gly-Asn-Phe-Phe-Arg-Lys-Ser-Lys-Gln-Lys-Ile-Gly-Lys-Gln-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asn-Phe-Phe-Arg-Asn-Leu-Val-Pro- Arg-Thr-Gln-Ser; H-LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS-OH

Molecular Formula

C208H343N65O48

Molecular Weight

4,522.46 g/mol

Controlled

No

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crystallin-αB Polyclonal Antibody
E20-71127 100 µg

Crystallin-αB Polyclonal Antibody

Sign In for Pricing
View Details
PRX Rabbit pAb
E45R23954N 50 ul

PRX Rabbit pAb

Sign In for Pricing
View Details
NXPE1 Antibody, FITC conjugated
MBS1494777-01 0.05 mg

NXPE1 Antibody, FITC conjugated

Sign In for Pricing
View Details
NXPE1 Antibody, FITC conjugated
MBS1494777-02 0.1 mg

NXPE1 Antibody, FITC conjugated

Sign In for Pricing
View Details
NXPE1 Antibody, FITC conjugated
MBS1494777-03 5x 0.1 mg

NXPE1 Antibody, FITC conjugated

Sign In for Pricing
View Details
LDL Receptor (LDLR) (NM_001195803) Human Tagged ORF Clone
RC231372 10 µg

LDL Receptor (LDLR) (NM_001195803) Human Tagged ORF Clone

Sign In for Pricing
View Details