Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL-37, Antimicrobial Peptide, human

Product Specifications

Synonyms

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro- Arg-Thr-Glu-Ser; H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH

Molecular Formula

C205H340N60O53

Molecular Weight

4,493.37 g/mol

Shipping Conditions

Cool Pack

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZDHHC12 Antibody [Alexa Fluor 750]
NBP3-05950AF750 0.1 mL

Rabbit Polyclonal ZDHHC12 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
SLC35A2 Antibody, HRP conjugated
A35007-50UG 50 µg

SLC35A2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Dsg3 Recombinant Protein
OPCA03183-100UG 100 µg

Dsg3 Recombinant Protein

Sign In for Pricing
View Details
Ccni Rabbit Polyclonal Antibody (FITC)
orb2092533 100 µL

Ccni Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Lentiviral mouse Otulin shRNA (UAS) - Lentiviral mouse Otulin shRNA (UAS, iRFP) (100)
GTR15250683 1 Vial

Lentiviral mouse Otulin shRNA (UAS) - Lentiviral mouse Otulin shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Anti-Human DLL3 Antibody (SAA1488), FITC
HP628217-01 1 Each

Anti-Human DLL3 Antibody (SAA1488), FITC

Sign In for Pricing
View Details