Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL-37, Antimicrobial Peptide, human

Product Specifications

Synonyms

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro- Arg-Thr-Glu-Ser; H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH

Molecular Formula

C205H340N60O53

Molecular Weight

4,493.37 g/mol

Shipping Conditions

Cool Pack

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6- (2- (2- ((6-Chlorohexyl) oxy) ethoxy) ethoxy) hexanoic acid
OR89388-01 100 mg

6- (2- (2- ((6-Chlorohexyl) oxy) ethoxy) ethoxy) hexanoic acid

Sign In for Pricing
View Details
6- (2- (2- ((6-Chlorohexyl) oxy) ethoxy) ethoxy) hexanoic acid
OR89388-02 250 mg

6- (2- (2- ((6-Chlorohexyl) oxy) ethoxy) ethoxy) hexanoic acid

Sign In for Pricing
View Details
6- (2- (2- ((6-Chlorohexyl) oxy) ethoxy) ethoxy) hexanoic acid
OR89388-03 1 g

6- (2- (2- ((6-Chlorohexyl) oxy) ethoxy) ethoxy) hexanoic acid

Sign In for Pricing
View Details
RBPMS2 Protein Vector (Mouse) (pPM-C-HA)
PV223128 500 ng

RBPMS2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ZCCHC7 Antibody - C-terminal region
ARP60538_P050-25UL 25 µL

ZCCHC7 Antibody - C-terminal region

Sign In for Pricing
View Details
MTMR9LP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV771481 1.0 µg DNA

MTMR9LP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details