Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL-37, Antimicrobial Peptide, human

Product Specifications

Synonyms

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro- Arg-Thr-Glu-Ser; H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH

Molecular Formula

C205H340N60O53

Molecular Weight

4,493.37 g/mol

Shipping Conditions

Cool Pack

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CDCA5 Protein
E30P10752 20 µg

Recombinant Human CDCA5 Protein

Sign In for Pricing
View Details
ZC3H7B (NM_017590) Human Tagged ORF Clone Lentiviral Particle
RC219566L3V 200 µL

ZC3H7B (NM_017590) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CSM Taq Polymerase
P1232 1000 U

CSM Taq Polymerase

Sign In for Pricing
View Details
Recombinant Cytokeratin 20 (CK 20)
TRV-0004568-01 10 µg

Recombinant Cytokeratin 20 (CK 20)

Sign In for Pricing
View Details
Recombinant Cytokeratin 20 (CK 20)
TRV-0004568-02 50 µg

Recombinant Cytokeratin 20 (CK 20)

Sign In for Pricing
View Details
Recombinant Cytokeratin 20 (CK 20)
TRV-0004568-03 100 µg

Recombinant Cytokeratin 20 (CK 20)

Sign In for Pricing
View Details