Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Intermedin-53 (human)

Product Specifications

Synonyms

His-Ser-Gly-Pro-Arg-Arg-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu- Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2; H-HSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGP

Molecular Formula

C247H397N83O73S3

Molecular Weight

5,793.61 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Complement C1q tumor necrosis factor-related protein 9, C1QTNF9 ELISA Kit
MBS1607554-01 48 Well

Rat Complement C1q tumor necrosis factor-related protein 9, C1QTNF9 ELISA Kit

Sign In for Pricing
View Details
Rat Complement C1q tumor necrosis factor-related protein 9, C1QTNF9 ELISA Kit
MBS1607554-02 96 Well

Rat Complement C1q tumor necrosis factor-related protein 9, C1QTNF9 ELISA Kit

Sign In for Pricing
View Details
Rat Complement C1q tumor necrosis factor-related protein 9, C1QTNF9 ELISA Kit
MBS1607554-03 5x 96 Well

Rat Complement C1q tumor necrosis factor-related protein 9, C1QTNF9 ELISA Kit

Sign In for Pricing
View Details
Rat Complement C1q tumor necrosis factor-related protein 9, C1QTNF9 ELISA Kit
MBS1607554-04 10x 96 Well

Rat Complement C1q tumor necrosis factor-related protein 9, C1QTNF9 ELISA Kit

Sign In for Pricing
View Details
ZNF121 CRISPR Knock Out 293T Cell Line (Human)
51299141 1x 10^6 Cells / 1.0 mL

ZNF121 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
MST1 Antibody
E19-8430-2 100 µg -100 µL

MST1 Antibody

Sign In for Pricing
View Details