Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Intermedin-53 (human)

Product Specifications

Synonyms

His-Ser-Gly-Pro-Arg-Arg-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu- Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2; H-HSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGP

Molecular Formula

C247H397N83O73S3

Molecular Weight

5,793.61 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human/Mouse Lumican MAb (Clone 358022)
MAB2846-SP 25 µg

Human/Mouse Lumican MAb (Clone 358022)

Sign In for Pricing
View Details
PHGDH Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV692793 1.0 µg DNA

PHGDH Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)
TRV-0032773-01 20 µL

Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details
Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)
TRV-0032773-02 100 µL

Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details
Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)
TRV-0032773-03 200 µL

Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details
Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)
TRV-0032773-04 1 mL

Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details