Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACAP-38, amide, frog

Product Specifications

Synonyms

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln- Arg-Ile-Lys-Asn-Lys-NH2; H-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2

Molecular Formula

C204H333N63O53S

Molecular Weight

4,548.38 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Exosome ELISA Kit
MBS3808774-01 48 Well

Rat Exosome ELISA Kit

Sign In for Pricing
View Details
Rat Exosome ELISA Kit
MBS3808774-02 96 Well

Rat Exosome ELISA Kit

Sign In for Pricing
View Details
Rat Exosome ELISA Kit
MBS3808774-03 5x 96 Well

Rat Exosome ELISA Kit

Sign In for Pricing
View Details
Rat Exosome ELISA Kit
MBS3808774-04 10x 96 Well

Rat Exosome ELISA Kit

Sign In for Pricing
View Details
FBXO3, CT (FBXO3, FBX3, F-box only protein 3) (MaxLight 750)
MBS6298404-01 0.1 mL

FBXO3, CT (FBXO3, FBX3, F-box only protein 3) (MaxLight 750)

Sign In for Pricing
View Details
FBXO3, CT (FBXO3, FBX3, F-box only protein 3) (MaxLight 750)
MBS6298404-02 5x 0.1 mL

FBXO3, CT (FBXO3, FBX3, F-box only protein 3) (MaxLight 750)

Sign In for Pricing
View Details