Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACAP-38, amide, frog

Product Specifications

Synonyms

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln- Arg-Ile-Lys-Asn-Lys-NH2; H-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2

Molecular Formula

C204H333N63O53S

Molecular Weight

4,548.38 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uromodulin (UMOD) Recombinant, Canine
157272-01 10 µg

Uromodulin (UMOD) Recombinant, Canine

Sign In for Pricing
View Details
Uromodulin (UMOD) Recombinant, Canine
157272-02 50 µg

Uromodulin (UMOD) Recombinant, Canine

Sign In for Pricing
View Details
Uromodulin (UMOD) Recombinant, Canine
157272-03 200 µg

Uromodulin (UMOD) Recombinant, Canine

Sign In for Pricing
View Details
Claudin 11 (CLDN11) Bovine ELISA Kit
C3979 96 Tests

Claudin 11 (CLDN11) Bovine ELISA Kit

Sign In for Pricing
View Details
TOPBP1 (Phospho-Ser1159) Rabbit Polyclonal Antibody
MBS9511987-01 0.05 mL

TOPBP1 (Phospho-Ser1159) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TOPBP1 (Phospho-Ser1159) Rabbit Polyclonal Antibody
MBS9511987-02 0.1 mL

TOPBP1 (Phospho-Ser1159) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details