Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Helodormin

Product Specifications

Synonyms

His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro- Pro-Pro-NH2; H-HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH2

Molecular Formula

C176H285N47O49

Molecular Weight

3,843.47 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNH4 Protein Vector (Rat) (pPM-C-HA)
PV275724 500 ng

KCNH4 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
PLK4, Active
MBS517423-01 0.01 mg

PLK4, Active

Sign In for Pricing
View Details
PLK4, Active
MBS517423-02 0.05 mg

PLK4, Active

Sign In for Pricing
View Details
PLK4, Active
MBS517423-03 0.5 mg

PLK4, Active

Sign In for Pricing
View Details
PLK4, Active
MBS517423-04 5x 0.5 mg

PLK4, Active

Sign In for Pricing
View Details
Polyethylene Glycol 6000 (PEG 6000)
462779-01 100 g

Polyethylene Glycol 6000 (PEG 6000)

Sign In for Pricing
View Details