Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Helodormin

Product Specifications

Synonyms

His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro- Pro-Pro-NH2; H-HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH2

Molecular Formula

C176H285N47O49

Molecular Weight

3,843.47 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish tfpia Antibody Fluoro488 Conjugated
DZ33957-Fluoro488 200 µL/Vial

Anti-Zebrafish tfpia Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
GPR142 rabbit pAb Antibody
orb768736-01 50 μL

GPR142 rabbit pAb Antibody

Sign In for Pricing
View Details
GPR142 rabbit pAb Antibody
orb768736-02 100 µL

GPR142 rabbit pAb Antibody

Sign In for Pricing
View Details
Genorise® Biotinylated monkey IL-13 polyclonal antibody
GR197010 50 mg

Genorise® Biotinylated monkey IL-13 polyclonal antibody

Sign In for Pricing
View Details
4-ArmPEG-Norbornene, 20K
A44279-20K-01 1 g

4-ArmPEG-Norbornene, 20K

Sign In for Pricing
View Details
4-ArmPEG-Norbornene, 20K
A44279-20K-02 5 g

4-ArmPEG-Norbornene, 20K

Sign In for Pricing
View Details