Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin-Lys (Biotin), human

Product Specifications

Synonyms

Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys (Biotin) ; H-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK (Biotin) -OH

Molecular Formula

C155H237N46O46S

Molecular Weight

3,511.95 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human KIR2DL3 protein (His tag)
PDMH100139-01 20 µg

Recombinant Human KIR2DL3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human KIR2DL3 protein (His tag)
PDMH100139-02 100 µg

Recombinant Human KIR2DL3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human KIR2DL3 protein (His tag)
PDMH100139-03 500 µg

Recombinant Human KIR2DL3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human KIR2DL3 protein (His tag)
PDMH100139-04 1 mg

Recombinant Human KIR2DL3 protein (His tag)

Sign In for Pricing
View Details
Superoxide Dismutase 1 (SOD1) (Antioxidant Enzyme) (SOD1/2089), CF488A conjugate, 0.1mg/mL
BNC882089-100 1x 100 µL

Superoxide Dismutase 1 (SOD1) (Antioxidant Enzyme) (SOD1/2089), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D,L-Azatryptophan Hydrate
TRC-A803575-1G 1 g

D,L-Azatryptophan Hydrate

Sign In for Pricing
View Details