Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin-Lys (Biotin), human

Product Specifications

Synonyms

Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys (Biotin) ; H-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK (Biotin) -OH

Molecular Formula

C155H237N46O46S

Molecular Weight

3,511.95 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSH2 Antibody
8C11748-AAT 50 µg

TSH2 Antibody

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF405S conjugate, 0.1mg/mL
BNC042497-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E3 ubiquitin protein ligase MUL1 (MUL1) (C-term) Rabbit Polyclonal Antibody
AP52776PU-N 400 µL

E3 ubiquitin protein ligase MUL1 (MUL1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Aromatase (CYP19A1) (NM_000103) Human Over-expression Lysate
LC400031 20 µg

Aromatase (CYP19A1) (NM_000103) Human Over-expression Lysate

Sign In for Pricing
View Details
Frataxin (Mitochondrial Marker) (rFXN/2124), CF647 conjugate, 0.1mg/mL
BNC473794-500 1x 500 µL

Frataxin (Mitochondrial Marker) (rFXN/2124), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HDAC3 (NM_003883) Human Over-expression Lysate
LC401280 20 µg

HDAC3 (NM_003883) Human Over-expression Lysate

Sign In for Pricing
View Details