Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAP-18, rabbit

Product Specifications

Synonyms

Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro- Arg-Thr-Asp-Tyr; H-GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY-OH

Molecular Formula

C202H356N64O47

Molecular Weight

4,433.49 g/mol

Controlled

No

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TK1 (Thymidine Kinase 1, Soluble, TK2) (MaxLight 550)
MBS6219689-01 0.1 mL

TK1 (Thymidine Kinase 1, Soluble, TK2) (MaxLight 550)

Sign In for Pricing
View Details
TK1 (Thymidine Kinase 1, Soluble, TK2) (MaxLight 550)
MBS6219689-02 5x 0.1 mL

TK1 (Thymidine Kinase 1, Soluble, TK2) (MaxLight 550)

Sign In for Pricing
View Details
HYAL3 discontinued
390237 200 µL

HYAL3 discontinued

Sign In for Pricing
View Details
P70 S6 Kinase (Phospho-Thr389) Rabbit mAb
14336 50 µL

P70 S6 Kinase (Phospho-Thr389) Rabbit mAb

Sign In for Pricing
View Details
Anti-BRD9 Antibody Picoband®, Carrier-free
A08420-1-carrier-free 100 µg/Vial

Anti-BRD9 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
HDHD1A Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-15433R-BF750 100 µL

HDHD1A Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details