Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAP-18, rabbit

Product Specifications

Synonyms

Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro- Arg-Thr-Asp-Tyr; H-GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY-OH

Molecular Formula

C202H356N64O47

Molecular Weight

4,433.49 g/mol

Controlled

No

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Adiponectin/ADIPOQ Antibody Picoband®, PE Conjugate
PB9011-PE 100 µg/Vial

Anti-Adiponectin/ADIPOQ Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
N- (3-Oxopentanoyl) -L-homoserine lactone
HY-141641-01 1 mg

N- (3-Oxopentanoyl) -L-homoserine lactone

Sign In for Pricing
View Details
N- (3-Oxopentanoyl) -L-homoserine lactone
HY-141641-02 5 mg

N- (3-Oxopentanoyl) -L-homoserine lactone

Sign In for Pricing
View Details
Methyl 2- (3-bromophenyl) -2-{[ (tert-butoxy) carbonyl]amino}propanoate
MKB91368-01 50 mg

Methyl 2- (3-bromophenyl) -2-{[ (tert-butoxy) carbonyl]amino}propanoate

Sign In for Pricing
View Details
Methyl 2- (3-bromophenyl) -2-{[ (tert-butoxy) carbonyl]amino}propanoate
MKB91368-02 0.5 g

Methyl 2- (3-bromophenyl) -2-{[ (tert-butoxy) carbonyl]amino}propanoate

Sign In for Pricing
View Details
YY1AP1 (YY1-Associated Protein 1, Hepatocellular Carcinoma Susceptibility Protein, Hepatocellular Carcinoma-Associated Protein 2, YY1AP1, HCCA2, YY1AP) (PE)
MBS6460308-01 0.2 mL

YY1AP1 (YY1-Associated Protein 1, Hepatocellular Carcinoma Susceptibility Protein, Hepatocellular Carcinoma-Associated Protein 2, YY1AP1, HCCA2, YY1AP) (PE)

Sign In for Pricing
View Details