Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Defensin-3, human

Product Specifications

Synonyms

Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys- Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys; H-GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK-OH

Molecular Formula

C216H371N75O59S6

Molecular Weight

5,155.22 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40L antibody
10-7890 500 ug

CD40L antibody

Sign In for Pricing
View Details
Mouse CD230 Antibody , FITC
E55A07071 50 Tests

Mouse CD230 Antibody , FITC

Sign In for Pricing
View Details
Human Monocyte differentiation antigen CD14 ELISA Kit
orb1661121 96 Tests

Human Monocyte differentiation antigen CD14 ELISA Kit

Sign In for Pricing
View Details
Arhgap4 sgRNA CRISPR Lentivector set (Mouse)
K4666101 3x 1.0 µg

Arhgap4 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Hsa-miR-570-5p miRNA Inhibitor
CIH1878-01 10 nmol

Hsa-miR-570-5p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-570-5p miRNA Inhibitor
CIH1878-02 20 nmol

Hsa-miR-570-5p miRNA Inhibitor

Sign In for Pricing
View Details