Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Defensin-3, human

Product Specifications

Synonyms

Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys- Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys; H-GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK-OH

Molecular Formula

C216H371N75O59S6

Molecular Weight

5,155.22 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEACAM1 Antibody, Biotin conjugated
A44228-100UG 100 µg

CEACAM1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
NPTX2 (NM_002523) Human Recombinant Protein
TP306713L 1 mg

NPTX2 (NM_002523) Human Recombinant Protein

Sign In for Pricing
View Details
NACC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1386406 1.0 µg DNA

NACC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
GRASP65 (GORASP1) Rabbit Polyclonal Antibody
TA344655 100 µL

GRASP65 (GORASP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMEM241 Peptide - C-terminal region
MBS3242957-01 0.1 mg

TMEM241 Peptide - C-terminal region

Sign In for Pricing
View Details
TMEM241 Peptide - C-terminal region
MBS3242957-02 5x 0.1 mg

TMEM241 Peptide - C-terminal region

Sign In for Pricing
View Details