Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Growth Hormone (1-43)

Product Specifications

Synonyms

Phe-Pro-Thr-Ile-Pro-Leu-Ser-Arg-Leu-Phe-Asp-Asn-Ala-Met-Leu-Arg-Ala-His-Arg-Leu-His-Gln-Leu-Ala-Phe-Asp-Thr-Tyr-Gln-Glu-Phe-Glu-Glu- Ala-Tyr-Ile-Pro-Lys-Glu-Gln-Lys-Tyr-Ser; H-FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS-OH

Molecular Formula

C240H358N62O67S

Molecular Weight

5,215.97 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pyruvate Dehydrogenase E2 Antibody
RC-16097-01 50 μL

Recombinant Pyruvate Dehydrogenase E2 Antibody

Sign In for Pricing
View Details
Recombinant Pyruvate Dehydrogenase E2 Antibody
RC-16097-02 100 µL

Recombinant Pyruvate Dehydrogenase E2 Antibody

Sign In for Pricing
View Details
Recombinant Pyruvate Dehydrogenase E2 Antibody
RC-16097-03 1 mL

Recombinant Pyruvate Dehydrogenase E2 Antibody

Sign In for Pricing
View Details
MAP2 Recombinant Chimeric Antibody Antibody
HA610301 100 µg

MAP2 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Atp2a1 Mouse Gene Knockout Kit (CRISPR)
KN501776 1 Kit

Atp2a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Streptavidin, Allophycocyanin Crosslinked Conjugate, 0.5 mg/ml
#29048-1mL 1x 1 mL

Streptavidin, Allophycocyanin Crosslinked Conjugate, 0.5 mg/ml

Sign In for Pricing
View Details