Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Growth Hormone (1-43)

Product Specifications

Synonyms

Phe-Pro-Thr-Ile-Pro-Leu-Ser-Arg-Leu-Phe-Asp-Asn-Ala-Met-Leu-Arg-Ala-His-Arg-Leu-His-Gln-Leu-Ala-Phe-Asp-Thr-Tyr-Gln-Glu-Phe-Glu-Glu- Ala-Tyr-Ile-Pro-Lys-Glu-Gln-Lys-Tyr-Ser; H-FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS-OH

Molecular Formula

C240H358N62O67S

Molecular Weight

5,215.97 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coumarin 6
TRC-C755505-500MG 500 mg

Coumarin 6

Sign In for Pricing
View Details
PMEPA1 / TMEPAI (Tumor Suppressor Oncoprotein) (PMEPA1/2697), CF640R conjugate, 0.1mg/mL
BNC402697-500 1x 500 µL

PMEPA1 / TMEPAI (Tumor Suppressor Oncoprotein) (PMEPA1/2697), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAM2 Recombinant Rabbit Monoclonal Antibody [JE41-91]
HA722557 100 µL

TRAM2 Recombinant Rabbit Monoclonal Antibody [JE41-91]

Sign In for Pricing
View Details
Tissue Protein Lysate, Stomach
CP565637 150 µg

Tissue Protein Lysate, Stomach

Sign In for Pricing
View Details
P2RX4 (NM_002560) Human Recombinant Protein
TP307613L 1 mg

P2RX4 (NM_002560) Human Recombinant Protein

Sign In for Pricing
View Details
N2-t-Boc-N6-(biotinamido-6-N-caproylamido)lysine
TRC-B642500-25MG 25 mg

N2-t-Boc-N6-(biotinamido-6-N-caproylamido)lysine

Sign In for Pricing
View Details