Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Growth Hormone (1-43)

Product Specifications

Synonyms

Phe-Pro-Thr-Ile-Pro-Leu-Ser-Arg-Leu-Phe-Asp-Asn-Ala-Met-Leu-Arg-Ala-His-Arg-Leu-His-Gln-Leu-Ala-Phe-Asp-Thr-Tyr-Gln-Glu-Phe-Glu-Glu- Ala-Tyr-Ile-Pro-Lys-Glu-Gln-Lys-Tyr-Ser; H-FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS-OH

Molecular Formula

C240H358N62O67S

Molecular Weight

5,215.97 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CD27 / TNFRSF7 Protein, His Tag
CD7-R52H9-100ug 100 µg

Rat CD27 / TNFRSF7 Protein, His Tag

Sign In for Pricing
View Details
AAV8 Rabbit Monoclonal Antibody [Clone ID: OTIR1F3]
TA594408 100 µL

AAV8 Rabbit Monoclonal Antibody [Clone ID: OTIR1F3]

Sign In for Pricing
View Details
Rhox4b Mouse Gene Knockout Kit (CRISPR)
KN514799 1 Kit

Rhox4b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cdk5r2 Mouse Gene Knockout Kit (CRISPR)
KN503044 1 Kit

Cdk5r2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
K63-linkage Specific Ubiquitin Recombinant Rabbit Monoclonal Antibody [JM09-67]
ET1703-07 100 µL

K63-linkage Specific Ubiquitin Recombinant Rabbit Monoclonal Antibody [JM09-67]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: bilateral
CB620809 1 Block

Frozen Tissue Blocks, Ovary: bilateral

Sign In for Pricing
View Details