Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuron Specific Peptide

Product Specifications

Synonyms

Asp-Val-Ser-Asp-Gly-Ser-Ala-Glu-Arg-Arg-Pro-Tyr-Thr-Arg-Met-Gly-Ser-Gly-Gly-Leu-Lys-Leu-His-Cys-Val-His-Pro-Ala-Asn-Cys-Pro-Gly-Gly- Leu-Met-Val-Thr; H-DVSDGSAERRPYTRMGSGGLKLHCVHPANCPGGLMVT-OH

Molecular Formula

C161H262N52O51S4

Molecular Weight

3,870.44 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALR3 Human Gene Knockout Kit (CRISPR)
KN420196 1 Kit

GALR3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Horse Vascular Endothelial Growth Factor (VEGF) ELISA Kit
MBS9929149-01 48 Well

Horse Vascular Endothelial Growth Factor (VEGF) ELISA Kit

Sign In for Pricing
View Details
Horse Vascular Endothelial Growth Factor (VEGF) ELISA Kit
MBS9929149-02 96 Well

Horse Vascular Endothelial Growth Factor (VEGF) ELISA Kit

Sign In for Pricing
View Details
Horse Vascular Endothelial Growth Factor (VEGF) ELISA Kit
MBS9929149-03 5x 96 Well

Horse Vascular Endothelial Growth Factor (VEGF) ELISA Kit

Sign In for Pricing
View Details
Horse Vascular Endothelial Growth Factor (VEGF) ELISA Kit
MBS9929149-04 10x 96 Well

Horse Vascular Endothelial Growth Factor (VEGF) ELISA Kit

Sign In for Pricing
View Details
CD3
PP160-6ml 6 mL

CD3

Sign In for Pricing
View Details