Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuron Specific Peptide

Product Specifications

Synonyms

Asp-Val-Ser-Asp-Gly-Ser-Ala-Glu-Arg-Arg-Pro-Tyr-Thr-Arg-Met-Gly-Ser-Gly-Gly-Leu-Lys-Leu-His-Cys-Val-His-Pro-Ala-Asn-Cys-Pro-Gly-Gly- Leu-Met-Val-Thr; H-DVSDGSAERRPYTRMGSGGLKLHCVHPANCPGGLMVT-OH

Molecular Formula

C161H262N52O51S4

Molecular Weight

3,870.44 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-0730R-BF594 100 µL

HSP27 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
RIPK1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61370R-BF405-01 20 µL

RIPK1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
RIPK1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61370R-BF405-02 100 µL

RIPK1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
9-Aminoacridine
TRC-A190880-1G 1 g

9-Aminoacridine

Sign In for Pricing
View Details
Nervonic Acid
OR1027346-01 100 mg

Nervonic Acid

Sign In for Pricing
View Details
Nervonic Acid
OR1027346-02 250 mg

Nervonic Acid

Sign In for Pricing
View Details