Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Gln11]-beta-Amyloid (1-40)

Product Specifications

Synonyms

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly- Leu-Met-Val-Gly-Gly-Val-Val; H-DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH

Molecular Formula

C194H296N54O57S

Molecular Weight

4,328.91 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Deoxy Blebbistatin
TRC-D232550-25MG 25 mg

Deoxy Blebbistatin

Sign In for Pricing
View Details
Vegfb Mouse Gene Knockout Kit (CRISPR)
KN518878 1 Kit

Vegfb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF568 conjugate, 0.1mg/mL
BNC682278-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSD3 (WHSC1L1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F11]
TA809975BM 100 µL

NSD3 (WHSC1L1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F11]

Sign In for Pricing
View Details
TF3-dUTP *1 mM in TE Buffer (pH 7.5) *
17008-AAT 25 nmoles

TF3-dUTP *1 mM in TE Buffer (pH 7.5) *

Sign In for Pricing
View Details
Mouse Cdk5r2 activation kit by CRISPRa
GA200673 1 Kit

Mouse Cdk5r2 activation kit by CRISPRa

Sign In for Pricing
View Details