Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Gln11]-beta-Amyloid (1-40)

Product Specifications

Synonyms

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly- Leu-Met-Val-Gly-Gly-Val-Val; H-DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH

Molecular Formula

C194H296N54O57S

Molecular Weight

4,328.91 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLT28D1 (ALG13) Human Gene Knockout Kit (CRISPR)
KN402762 1 Kit

GLT28D1 (ALG13) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Benzhydrylazetidin-3-ol
TRC-B195500-500MG 500 mg

1-Benzhydrylazetidin-3-ol

Sign In for Pricing
View Details
ZFP200 (ZNF200) Mouse Monoclonal Antibody [Clone ID: OTI7C6]
CF808209 100 µg

ZFP200 (ZNF200) Mouse Monoclonal Antibody [Clone ID: OTI7C6]

Sign In for Pricing
View Details
LRRC8C (NM_032270) Human Recombinant Protein
TP322603L 1 mg

LRRC8C (NM_032270) Human Recombinant Protein

Sign In for Pricing
View Details
Galectin 2 (LGALS2) Rabbit Polyclonal Antibody
AP02095SU-N 100 µL

Galectin 2 (LGALS2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DMRTB1 (NM_033067) Human Recombinant Protein
TP318956 20 µg

DMRTB1 (NM_033067) Human Recombinant Protein

Sign In for Pricing
View Details