Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-49)

Product Specifications

Synonyms

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly- Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-Val-Ile-Val-Ile-Thr-Leu; H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL-OH

Molecular Formula

C239H376N62O69S

Molecular Weight

5,253.97 g/mol

Controlled

No

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT7 Antibody
OACA10355-100UG 100 µg

KRT7 Antibody

Sign In for Pricing
View Details
PDK4 Antibody
14-927 100 µL

PDK4 Antibody

Sign In for Pricing
View Details
mmu-miR-702 miRNA Antagomir
MNM02802 2x 5.0 nmol

mmu-miR-702 miRNA Antagomir

Sign In for Pricing
View Details
MTS-17-O5-MTS
sc-218886 25 mg

MTS-17-O5-MTS

Sign In for Pricing
View Details
4-Ethoxycinnamic acid
OR27550 1 Each

4-Ethoxycinnamic acid

Sign In for Pricing
View Details
Recombinant Human CD137/TNFRSF9/4-1BB Protein, C-His
bs-105109P-01 20 µg

Recombinant Human CD137/TNFRSF9/4-1BB Protein, C-His

Sign In for Pricing
View Details