Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-49)

Product Specifications

Synonyms

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly- Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-Val-Ile-Val-Ile-Thr-Leu; H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL-OH

Molecular Formula

C239H376N62O69S

Molecular Weight

5,253.97 g/mol

Controlled

No

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

H ZDHHC13 Expression Lentivirus
LVP469 1x 10^7 IFU/mL - 200 μL

H ZDHHC13 Expression Lentivirus

Sign In for Pricing
View Details
Rabphilin 3A (RPH3A) (NM_001143854) Human Tagged Lenti ORF Clone
RC226947L4 10 µg

Rabphilin 3A (RPH3A) (NM_001143854) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DEFA1/3 discontinued
388256 200 µL

DEFA1/3 discontinued

Sign In for Pricing
View Details
CT47A2 sgRNA CRISPR Lentivector (Human) (Target 3)
K0522304 1.0 µg DNA

CT47A2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
CDH18 Polyclonal Antibody
MBS9134643-01 0.02 mL

CDH18 Polyclonal Antibody

Sign In for Pricing
View Details
CDH18 Polyclonal Antibody
MBS9134643-02 0.1 mL

CDH18 Polyclonal Antibody

Sign In for Pricing
View Details