Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-49)

Product Specifications

Synonyms

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly- Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-Val-Ile-Val-Ile-Thr-Leu; H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL-OH

Molecular Formula

C239H376N62O69S

Molecular Weight

5,253.97 g/mol

Controlled

No

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASIC1 Antibody
37430 100 µL

ASIC1 Antibody

Sign In for Pricing
View Details
AHN 1-055 hydrochloride
M28222-01 1 g

AHN 1-055 hydrochloride

Sign In for Pricing
View Details
AHN 1-055 hydrochloride
M28222-02 500 mg

AHN 1-055 hydrochloride

Sign In for Pricing
View Details
AHN 1-055 hydrochloride
M28222-03 5 mg

AHN 1-055 hydrochloride

Sign In for Pricing
View Details
AHN 1-055 hydrochloride
M28222-04 10 mg

AHN 1-055 hydrochloride

Sign In for Pricing
View Details
AHN 1-055 hydrochloride
M28222-05 25 mg

AHN 1-055 hydrochloride

Sign In for Pricing
View Details