Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Des-Asp10]Decorsin, Leech

Product Specifications

Synonyms

Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala- Asp-Pro-Tyr-Cys-Glu; H-APRLPQCQGDQEKCLCNKDECPPGQCRFPRGDADPYCE-OH

Molecular Formula

C175H272N54O59S6

Molecular Weight

4,268.78 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDHA1 Recombinant Antibody, APC Conjugated
bsm-60685R-APC-TR 20 µL

PDHA1 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
MPS1 Inhibitor, NMS-P715 ((N- (2,6-diethylphenyl) -1-methyl-8- ({4-[ (1-methylpiperidin-4-yl) carbamoyl]-2- (trifluoromethoxy) phenyl}amino) -4,5-dihydro-1H-pyrazolo[4,3-h]quinazoline-3-carboxamide) )
217565 5 mg

MPS1 Inhibitor, NMS-P715 ((N- (2,6-diethylphenyl) -1-methyl-8- ({4-[ (1-methylpiperidin-4-yl) carbamoyl]-2- (trifluoromethoxy) phenyl}amino) -4,5-dihydro-1H-pyrazolo[4,3-h]quinazoline-3-carboxamide) )

Sign In for Pricing
View Details
Trnau1ap sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4778805 3x 1.0 µg

Trnau1ap sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
(S) -2,2',2'',2'''- (2- (4-Isothiocyanatobenzyl) -1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrayl) tetraacetic acid
OR1070282-01 5 mg

(S) -2,2',2'',2'''- (2- (4-Isothiocyanatobenzyl) -1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrayl) tetraacetic acid

Sign In for Pricing
View Details
(S) -2,2',2'',2'''- (2- (4-Isothiocyanatobenzyl) -1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrayl) tetraacetic acid
OR1070282-02 10 mg

(S) -2,2',2'',2'''- (2- (4-Isothiocyanatobenzyl) -1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrayl) tetraacetic acid

Sign In for Pricing
View Details
(S) -2,2',2'',2'''- (2- (4-Isothiocyanatobenzyl) -1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrayl) tetraacetic acid
OR1070282-03 25 mg

(S) -2,2',2'',2'''- (2- (4-Isothiocyanatobenzyl) -1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrayl) tetraacetic acid

Sign In for Pricing
View Details