Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Des-Asp10]Decorsin, Leech

Product Specifications

Synonyms

Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala- Asp-Pro-Tyr-Cys-Glu; H-APRLPQCQGDQEKCLCNKDECPPGQCRFPRGDADPYCE-OH

Molecular Formula

C175H272N54O59S6

Molecular Weight

4,268.78 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mapk13 3'UTR Lenti-reporter-Luc Vector
28056084 1.0 µg

Mapk13 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Human CRISP2 Protein, N-His
E55P1198 50 µg

Recombinant Human CRISP2 Protein, N-His

Sign In for Pricing
View Details
Human Fibrillin 1 (FBN1) ELISA Kit
DLR-FBN1-Hu-01 48 Tests

Human Fibrillin 1 (FBN1) ELISA Kit

Sign In for Pricing
View Details
Human Fibrillin 1 (FBN1) ELISA Kit
DLR-FBN1-Hu-02 96 Tests

Human Fibrillin 1 (FBN1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal to Human CTSG / Cathepsin G
MBS248336-01 0.05 mL

Rabbit Polyclonal to Human CTSG / Cathepsin G

Sign In for Pricing
View Details
Rabbit Polyclonal to Human CTSG / Cathepsin G
MBS248336-02 5x 0.05 mL

Rabbit Polyclonal to Human CTSG / Cathepsin G

Sign In for Pricing
View Details