Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Decorsin, Leech

Product Specifications

Synonyms

Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp- Ala-Asp-Pro-Tyr-Cys-Glu; H-APRLPQCQGDDQEKCLCNKDECPPGQCRFPRGDADPYCE-OH

Molecular Formula

C179H277N55O62S6

Molecular Weight

4,383.87 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Sarilumab Neutralizing Recombinant Antibody (SAA2883)
AY583083-01 50 µg

Anti-Sarilumab Neutralizing Recombinant Antibody (SAA2883)

Sign In for Pricing
View Details
Anti-Sarilumab Neutralizing Recombinant Antibody (SAA2883)
AY583083-02 100 µg

Anti-Sarilumab Neutralizing Recombinant Antibody (SAA2883)

Sign In for Pricing
View Details
Human Dopamine Receptor D3 (DRD3) ELISA Kit
orb775438-01 48 Tests

Human Dopamine Receptor D3 (DRD3) ELISA Kit

Sign In for Pricing
View Details
Human Dopamine Receptor D3 (DRD3) ELISA Kit
orb775438-02 96 Tests

Human Dopamine Receptor D3 (DRD3) ELISA Kit

Sign In for Pricing
View Details
C7orf52 (NAT16) (NM_198571) Human Over-expression Lysate
LS375607 100 µg

C7orf52 (NAT16) (NM_198571) Human Over-expression Lysate

Sign In for Pricing
View Details
Ku70/XRCC6 Rabbit Polyclonal Antibody (PE)
orb2621065 100 µg

Ku70/XRCC6 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details