Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (2-40)

Product Specifications

Synonyms

Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu- Met-Val-Gly-Gly-Val-Val; H-AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH

Molecular Formula

C190H290N52O55S

Molecular Weight

4,214.81 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL9/13 (D-4) PE
sc-166486 PE 200 µg/mL

KLHL9/13 (D-4) PE

Sign In for Pricing
View Details
Anti-T4/Thyroxine Antibody (SAA2032)
RGN27301 100 μg

Anti-T4/Thyroxine Antibody (SAA2032)

Sign In for Pricing
View Details
Compound NP-007591
T130393-01 10 mg

Compound NP-007591

Sign In for Pricing
View Details
Compound NP-007591
T130393-02 1 g

Compound NP-007591

Sign In for Pricing
View Details
Compound NP-007591
T130393-03 1 mg

Compound NP-007591

Sign In for Pricing
View Details
Compound NP-007591
T130393-04 50 mg

Compound NP-007591

Sign In for Pricing
View Details