What is the catalog number for Beta-Amyloid (2-40)?

The catalog number for Beta-Amyloid (2-40) is VAC-00212.

What sizes are available for Beta-Amyloid (2-40)?

Beta-Amyloid (2-40) is available in the following size(s): 1 mg, 5 mg, 10 mg.

How many pack sizes does Beta-Amyloid (2-40) come in?

Beta-Amyloid (2-40) is available in 3 different pack sizes.

Is Beta-Amyloid (2-40) in stock?

Beta-Amyloid (2-40) is currently made to order / not held in immediate stock. Contact us for lead time.

Beta-Amyloid (2-40)

Product Specifications

Synonyms

Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu- Met-Val-Gly-Gly-Val-Val; H-AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH

Molecular Formula

C190H290N52O55S

Molecular Weight

4,214.81 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E034201 100 µg -100 µL

CMKLR1 Antibody

Sign In for Pricing

View Details

bs-9498R-Cy3 100 µL

C9orf153 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing

View Details

GTR15333441 1 Vial

Lentiviral human SLC22A15 shRNA (UAS) - Lentiviral human SLC22A15 shRNA (UAS) (100)

Sign In for Pricing

View Details

EK9F335-01 48 Test

Chicken X-C Motif Chemokine Ligand 1 (XCL1) ELISA Kit-Sandwich

Sign In for Pricing

View Details

EK9F335-02 96 Tests

Chicken X-C Motif Chemokine Ligand 1 (XCL1) ELISA Kit-Sandwich

Sign In for Pricing

View Details

SI012409B 1 Each

Human PLXNA1 Pre-designed siRNA Set B

Sign In for Pricing

View Details