Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (2-40)

Product Specifications

Synonyms

Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu- Met-Val-Gly-Gly-Val-Val; H-AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH

Molecular Formula

C190H290N52O55S

Molecular Weight

4,214.81 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDCG3, NT (Antigen NY-CO-3, Serologically defined colon cancer antigen 3,SDCCAG3) (Biotin)
MBS6345582-01 0.2 mL

SDCG3, NT (Antigen NY-CO-3, Serologically defined colon cancer antigen 3,SDCCAG3) (Biotin)

Sign In for Pricing
View Details
SDCG3, NT (Antigen NY-CO-3, Serologically defined colon cancer antigen 3,SDCCAG3) (Biotin)
MBS6345582-02 5x 0.2 mL

SDCG3, NT (Antigen NY-CO-3, Serologically defined colon cancer antigen 3,SDCCAG3) (Biotin)

Sign In for Pricing
View Details
Rabbit ZBTB5 Antibody
orb1523670-01 10 µL

Rabbit ZBTB5 Antibody

Sign In for Pricing
View Details
Rabbit ZBTB5 Antibody
orb1523670-02 100 µL

Rabbit ZBTB5 Antibody

Sign In for Pricing
View Details
RTP4 Polyclonal Antibody, PE-Cy5 Conjugated
bs-11618R-PE-Cy5 100 µL

RTP4 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Recombinant Human SRPK2 Protein - (Dry Ice)
H00006733-P02-25ug 25 µg

Recombinant Human SRPK2 Protein - (Dry Ice)

Sign In for Pricing
View Details