Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (2-40)

Product Specifications

Synonyms

Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu- Met-Val-Gly-Gly-Val-Val; H-AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH

Molecular Formula

C190H290N52O55S

Molecular Weight

4,214.81 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hspb7 antibody - C-terminal region (ARP41601_P050)
ARP41601_P050 100 µL

Hspb7 antibody - C-terminal region (ARP41601_P050)

Sign In for Pricing
View Details
SHP2 Antibody / PTPN11
F53772-0.4ML 0.4 mL

SHP2 Antibody / PTPN11

Sign In for Pricing
View Details
Rabbit Monoclonal Actin (Muscle Specific) Antibody (MSA/8949R) [Biotin]
NBP3-24247B 0.1 mL

Rabbit Monoclonal Actin (Muscle Specific) Antibody (MSA/8949R) [Biotin]

Sign In for Pricing
View Details
Guinea Pig Cholinesterase (BCHE) ELISA kit
GTR10428734 96 Well

Guinea Pig Cholinesterase (BCHE) ELISA kit

Sign In for Pricing
View Details
GAS7 Recombinant Protein (Mouse)
RP135962 100 µg

GAS7 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Ribitol (Adonitol) 10mM * 1mL in DMSO
A11185-10mM-D 10 mM x 1mL in DMSO

Ribitol (Adonitol) 10mM * 1mL in DMSO

Sign In for Pricing
View Details