Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Big Gastrin-1, human

Product Specifications

Synonyms

Pyr-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp- Phe-NH2; H- (Pyr) LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2

Molecular Formula

C176H251N43O53S

Molecular Weight

3,849.30 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HURP (D-12)
sc-376760 200 µg/mL

HURP (D-12)

Sign In for Pricing
View Details
DnaJ homolog subfamily C member 1 (DNAJC1) Mouse ELISA Kit
C9738 96 Tests

DnaJ homolog subfamily C member 1 (DNAJC1) Mouse ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal GNPDA2 Antibody [Janelia Fluor 646]
NBP1-76997JF646 0.1 mL

Rabbit Polyclonal GNPDA2 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
FlashBAC PRIME
100503 96 Reactions

FlashBAC PRIME

Sign In for Pricing
View Details
LZTFL1 (Leucine zipper Transcription Factor-like 1, FLJ36386) (MaxLight 550)
248371-ML550 100 µL

LZTFL1 (Leucine zipper Transcription Factor-like 1, FLJ36386) (MaxLight 550)

Sign In for Pricing
View Details
Rabbit Anti Human ADAP1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)
MBS8422226-01 0.12 mL

Rabbit Anti Human ADAP1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)

Sign In for Pricing
View Details