Big Gastrin-1, human
Product Specifications
Synonyms
Pyr-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp- Phe-NH2; H- (Pyr) LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
Molecular Formula
C176H251N43O53S
Molecular Weight
3,849.30 g/mol
Controlled
No
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7146237 Inquire
Rabbit anti-Oryza sativa subsp. japonica (Rice) BRI1 Polyclonal Antibody
Sign In for Pricing
View Details 
MBS2168169-01 0.1 mL
HRP-Linked Monoclonal Antibody to Fibroblast Growth Factor Receptor 3 (FGFR3)
Sign In for Pricing
View Details MBS2168169-02 0.2 mL
HRP-Linked Monoclonal Antibody to Fibroblast Growth Factor Receptor 3 (FGFR3)
Sign In for Pricing
View Details MBS2168169-03 0.5 mL
HRP-Linked Monoclonal Antibody to Fibroblast Growth Factor Receptor 3 (FGFR3)
Sign In for Pricing
View Details MBS2168169-04 1 mL
HRP-Linked Monoclonal Antibody to Fibroblast Growth Factor Receptor 3 (FGFR3)
Sign In for Pricing
View Details