Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Big Gastrin-1, human

Product Specifications

Synonyms

Pyr-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp- Phe-NH2; H- (Pyr) LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2

Molecular Formula

C176H251N43O53S

Molecular Weight

3,849.30 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hnRNP A/B CRISPR Activation Plasmid (m)
sc-420896-ACT 20 µg

hnRNP A/B CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Mouse IgG2b Isotype Control Antibody (GC198)
ABS-427-100ug 100 µg

Mouse IgG2b Isotype Control Antibody (GC198)

Sign In for Pricing
View Details
PHF20L1 Protein Vector (Human) (pPM-C-HA)
PV031095 500 ng

PHF20L1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Actin α1 Polyclonal Antibody
orb310091-01 50 μL

Actin α1 Polyclonal Antibody

Sign In for Pricing
View Details
Actin α1 Polyclonal Antibody
orb310091-02 100 µL

Actin α1 Polyclonal Antibody

Sign In for Pricing
View Details
TRF1 Polyclonal Antibody
MBS9245475-01 0.1 mL

TRF1 Polyclonal Antibody

Sign In for Pricing
View Details