Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Big Gastrin-1, human

Product Specifications

Synonyms

Pyr-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp- Phe-NH2; H- (Pyr) LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2

Molecular Formula

C176H251N43O53S

Molecular Weight

3,849.30 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Analog magnetic stirrer heating up to 550 °C, glass ceramic surface, incl. Temp. Sensor PT-1000
RSM-04H 1 Each

Analog magnetic stirrer heating up to 550 °C, glass ceramic surface, incl. Temp. Sensor PT-1000

Sign In for Pricing
View Details
2,4-Dichlorobenzonitrile
sc-275322 5 g

2,4-Dichlorobenzonitrile

Sign In for Pricing
View Details
PEX12 CytoSection
TS406293P5 25 Slides

PEX12 CytoSection

Sign In for Pricing
View Details
Porcine heat shock protein (HSP - 20) ELISA Kit
QY-E40086 96 Tests

Porcine heat shock protein (HSP - 20) ELISA Kit

Sign In for Pricing
View Details
Human Anti-Borrelia burgdorferi IgM (Anti-Bb IgM) ELISA Kit
SL4699Hu-01 48 Tests

Human Anti-Borrelia burgdorferi IgM (Anti-Bb IgM) ELISA Kit

Sign In for Pricing
View Details
Human Anti-Borrelia burgdorferi IgM (Anti-Bb IgM) ELISA Kit
SL4699Hu-02 96 Tests

Human Anti-Borrelia burgdorferi IgM (Anti-Bb IgM) ELISA Kit

Sign In for Pricing
View Details