What is the catalog number for Amyloid Dan Protein (1-34) (reduced)?

The catalog number for Amyloid Dan Protein (1-34) (reduced) is VAC-00167.

What sizes are available for Amyloid Dan Protein (1-34) (reduced)?

Amyloid Dan Protein (1-34) (reduced) is available in the following size(s): 1 mg, 5 mg, 10 mg.

How many pack sizes does Amyloid Dan Protein (1-34) (reduced) come in?

Amyloid Dan Protein (1-34) (reduced) is available in 3 different pack sizes.

Is Amyloid Dan Protein (1-34) (reduced) in stock?

Amyloid Dan Protein (1-34) (reduced) is currently made to order / not held in immediate stock. Contact us for lead time.

Amyloid Dan Protein (1-34) (reduced)

Product Specifications

Synonyms

Pyr-Ala-Ser-Asn-Cys-Phe-Ala-Ile-Arg-His-Phe-Glu-Asn-Lys-Phe-Ala-Val-Glu-Thr-Leu-Ile-Cys-Phe-Asn-Leu-Phe-Leu-Asn-Ser-Gln-Glu-Lys-His- Tyr; H- (Pyr) ASNCFAIRHFENKFAVETLICFNLFLNSQEKHY-OH

Molecular Formula

C185H270N48O51S2

Molecular Weight

4,046.63 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OKCD08862 96 Well

STC2 ELISA Kit (Human) (OKCD08862)

Sign In for Pricing

View Details

PC410145 1 Each

2- (4-Fluorophenyl) imidazo[1,2-a]pyrimidine-3-carbaldehyde

Sign In for Pricing

View Details

TU256957 1.0 mL

Lat2 3'UTR GFP Stable Cell Line

Sign In for Pricing

View Details

SIPA006Ra01-01 10 µg

Recombinant Connective Tissue Growth Factor (CTGF)

Sign In for Pricing

View Details

SIPA006Ra01-02 50 µg

Recombinant Connective Tissue Growth Factor (CTGF)

Sign In for Pricing

View Details

SIPA006Ra01-03 200 µg

Recombinant Connective Tissue Growth Factor (CTGF)

Sign In for Pricing

View Details