What is the catalog number for Amyloid Dan Protein (1-34) (reduced)?

The catalog number for Amyloid Dan Protein (1-34) (reduced) is VAC-00167.

What sizes are available for Amyloid Dan Protein (1-34) (reduced)?

Amyloid Dan Protein (1-34) (reduced) is available in the following size(s): 1 mg, 5 mg, 10 mg.

How many pack sizes does Amyloid Dan Protein (1-34) (reduced) come in?

Amyloid Dan Protein (1-34) (reduced) is available in 3 different pack sizes.

Is Amyloid Dan Protein (1-34) (reduced) in stock?

Amyloid Dan Protein (1-34) (reduced) is currently made to order / not held in immediate stock. Contact us for lead time.

Amyloid Dan Protein (1-34) (reduced)

Product Specifications

Synonyms

Pyr-Ala-Ser-Asn-Cys-Phe-Ala-Ile-Arg-His-Phe-Glu-Asn-Lys-Phe-Ala-Val-Glu-Thr-Leu-Ile-Cys-Phe-Asn-Leu-Phe-Leu-Asn-Ser-Gln-Glu-Lys-His- Tyr; H- (Pyr) ASNCFAIRHFENKFAVETLICFNLFLNSQEKHY-OH

Molecular Formula

C185H270N48O51S2

Molecular Weight

4,046.63 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb828567 2 mg

RpsI Antibody

Sign In for Pricing

View Details

H7965-02-APC 100 µL

Huntingtin Protein (Huntington Disease) (APC) discontinued

Sign In for Pricing

View Details

TL506678 1 Kit

Clic5 Mouse shRNA Plasmid (Locus ID 224796)

Sign In for Pricing

View Details

TA397039 100 µg

CPA1 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

10007054 1.0 mL

0610009D07RIK Adenovirus (Mouse)

Sign In for Pricing

View Details

446286-01 1 mg

Desethylene Posaconazole N, N’-Diformyl

Sign In for Pricing

View Details