Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amyloid Dan Protein (1-34) (reduced)

Product Specifications

Synonyms

Pyr-Ala-Ser-Asn-Cys-Phe-Ala-Ile-Arg-His-Phe-Glu-Asn-Lys-Phe-Ala-Val-Glu-Thr-Leu-Ile-Cys-Phe-Asn-Leu-Phe-Leu-Asn-Ser-Gln-Glu-Lys-His- Tyr; H- (Pyr) ASNCFAIRHFENKFAVETLICFNLFLNSQEKHY-OH

Molecular Formula

C185H270N48O51S2

Molecular Weight

4,046.63 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myoz2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3752003 1.0 µg DNA

Myoz2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
ITIH1, ID (ITIH1, IGHEP1, Inter-alpha-trypsin inhibitor heavy chain H1, Inter-alpha-trypsin inhibitor complex component III, Serum-derived hyaluronan-associated protein) (APC)
MBS6311324-01 0.2 mL

ITIH1, ID (ITIH1, IGHEP1, Inter-alpha-trypsin inhibitor heavy chain H1, Inter-alpha-trypsin inhibitor complex component III, Serum-derived hyaluronan-associated protein) (APC)

Sign In for Pricing
View Details
ITIH1, ID (ITIH1, IGHEP1, Inter-alpha-trypsin inhibitor heavy chain H1, Inter-alpha-trypsin inhibitor complex component III, Serum-derived hyaluronan-associated protein) (APC)
MBS6311324-02 5x 0.2 mL

ITIH1, ID (ITIH1, IGHEP1, Inter-alpha-trypsin inhibitor heavy chain H1, Inter-alpha-trypsin inhibitor complex component III, Serum-derived hyaluronan-associated protein) (APC)

Sign In for Pricing
View Details
Irf2-set siRNA/shRNA/RNAi Lentivector (Mouse)
25078094 4x 500 ng

Irf2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
PPHLN1 (NM_201440) Human Untagged Clone
SC308032 10 µg

PPHLN1 (NM_201440) Human Untagged Clone

Sign In for Pricing
View Details
PDZ Domain Containing 1 Protein
abx261058-01 5 µg

PDZ Domain Containing 1 Protein

Sign In for Pricing
View Details