What is the catalog number for Amyloid Dan Protein (1-34) (reduced)?

The catalog number for Amyloid Dan Protein (1-34) (reduced) is VAC-00167.

What sizes are available for Amyloid Dan Protein (1-34) (reduced)?

Amyloid Dan Protein (1-34) (reduced) is available in the following size(s): 1 mg, 5 mg, 10 mg.

How many pack sizes does Amyloid Dan Protein (1-34) (reduced) come in?

Amyloid Dan Protein (1-34) (reduced) is available in 3 different pack sizes.

Is Amyloid Dan Protein (1-34) (reduced) in stock?

Amyloid Dan Protein (1-34) (reduced) is currently made to order / not held in immediate stock. Contact us for lead time.

Amyloid Dan Protein (1-34) (reduced)

Product Specifications

Synonyms

Pyr-Ala-Ser-Asn-Cys-Phe-Ala-Ile-Arg-His-Phe-Glu-Asn-Lys-Phe-Ala-Val-Glu-Thr-Leu-Ile-Cys-Phe-Asn-Leu-Phe-Leu-Asn-Ser-Gln-Glu-Lys-His- Tyr; H- (Pyr) ASNCFAIRHFENKFAVETLICFNLFLNSQEKHY-OH

Molecular Formula

C185H270N48O51S2

Molecular Weight

4,046.63 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

009821 50 mg

S-N-[2- (2,3-Dihydro-6-methoxy-1H-inden-1-yl) ethyl]propanamide

Sign In for Pricing

View Details

TRC-H939990-2.5MG 2.5 mg

(3R,4S,5S)-4-Hydroxy-3-(pentan-3-yloxy)-5-(tosyloxy)cyclohex-1-enecarboxylic Acid

Sign In for Pricing

View Details

13023164 1.0 µg

Batf AAV siRNA Pooled Vector

Sign In for Pricing

View Details

13574166 1.0 µg

Btnl7 AAV siRNA Pooled Vector

Sign In for Pricing

View Details

TU117084 1.0 mL

Prrx1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing

View Details

MBS1497581-01 0.05 mg

PFDN4 Antibody, HRP conjugated

Sign In for Pricing

View Details