Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[D-Asp1]-Amyloid-beta-Protein (1-42)

Product Specifications

Synonyms

D-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala; H- (dD) AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH

Molecular Formula

C203H311N55O60S

Molecular Weight

4,514.14 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3 zeta (YWHAZ) Rabbit Polyclonal Antibody
TA325984 100 µL

14-3-3 zeta (YWHAZ) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Complement C1s Subcomponent (C1S) Antibody
abx421735-01 50 µg

Complement C1s Subcomponent (C1S) Antibody

Sign In for Pricing
View Details
Complement C1s Subcomponent (C1S) Antibody
abx421735-02 100 µg

Complement C1s Subcomponent (C1S) Antibody

Sign In for Pricing
View Details
LEPRE1 (P3H1) (NM_001146289) Human Tagged Lenti ORF Clone
RC229000L4 10 µg

LEPRE1 (P3H1) (NM_001146289) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
KRT76 3'UTR Luciferase Stable Cell Line
TU012083 1.0 mL

KRT76 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mael Rat Pre-designed siRNA Set A
HY-RS27889 1 Set

Mael Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details