Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ac-beta-Endorphin (human)

Product Specifications

Synonyms

Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; Ac-YG GFMTSEKSQTPLVTLFKNAIIKNAYKKGE-OH

Molecular Formula

C160H253N39O47S

Molecular Weight

3,507.01 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal RELT/TNFRSF19L Antibody (111) [Alexa Fluor 488]
NBP2-89555AF488 0.1 mL

Rabbit Monoclonal RELT/TNFRSF19L Antibody (111) [Alexa Fluor 488]

Sign In for Pricing
View Details
ABL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0024008 1.0 µg DNA

ABL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PASD1 (PAS Domain-containing Protein 1, Cancer/Testis Antigen 63, CT63, OX-TES-1) (Biotin)
MBS6143377-01 0.1 mL

PASD1 (PAS Domain-containing Protein 1, Cancer/Testis Antigen 63, CT63, OX-TES-1) (Biotin)

Sign In for Pricing
View Details
PASD1 (PAS Domain-containing Protein 1, Cancer/Testis Antigen 63, CT63, OX-TES-1) (Biotin)
MBS6143377-02 5x 0.1 mL

PASD1 (PAS Domain-containing Protein 1, Cancer/Testis Antigen 63, CT63, OX-TES-1) (Biotin)

Sign In for Pricing
View Details
Anti-TNFR2 antibody
PAab08824 100 µg

Anti-TNFR2 antibody

Sign In for Pricing
View Details
Rabbit anti Mouse IgG1 IgG2a IgG2b IgG3 (heavy and light chains), conjugated with TRITC
MBS571746-01 2 mL

Rabbit anti Mouse IgG1 IgG2a IgG2b IgG3 (heavy and light chains), conjugated with TRITC

Sign In for Pricing
View Details