Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ac-beta-Endorphin (human)

Product Specifications

Synonyms

Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; Ac-YG GFMTSEKSQTPLVTLFKNAIIKNAYKKGE-OH

Molecular Formula

C160H253N39O47S

Molecular Weight

3,507.01 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QSK Polyclonal Antibody
RA29135-01 50 µL

QSK Polyclonal Antibody

Sign In for Pricing
View Details
QSK Polyclonal Antibody
RA29135-02 100 µL

QSK Polyclonal Antibody

Sign In for Pricing
View Details
TNK1 Antibody
MBS9213475-01 0.08 mL

TNK1 Antibody

Sign In for Pricing
View Details
TNK1 Antibody
MBS9213475-02 0.4 mL

TNK1 Antibody

Sign In for Pricing
View Details
TNK1 Antibody
MBS9213475-03 5x 0.4 mL

TNK1 Antibody

Sign In for Pricing
View Details
7B2 Polyclonal Antibody
UB-GEN-5695 100 µL

7B2 Polyclonal Antibody

Sign In for Pricing
View Details