Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ac-beta-Endorphin (human)

Product Specifications

Synonyms

Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; Ac-YG GFMTSEKSQTPLVTLFKNAIIKNAYKKGE-OH

Molecular Formula

C160H253N39O47S

Molecular Weight

3,507.01 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZCCHC4 Antibody
NBP2-97816-50ul 50 µL

Rabbit Polyclonal ZCCHC4 Antibody

Sign In for Pricing
View Details
METAP1D Rabbit pAb
MBS8559709-01 0.1 mL

METAP1D Rabbit pAb

Sign In for Pricing
View Details
METAP1D Rabbit pAb
MBS8559709-02 0.1 mL (AF405L)

METAP1D Rabbit pAb

Sign In for Pricing
View Details
METAP1D Rabbit pAb
MBS8559709-03 0.1 mL (AF405S)

METAP1D Rabbit pAb

Sign In for Pricing
View Details
METAP1D Rabbit pAb
MBS8559709-04 0.1 mL (AF610)

METAP1D Rabbit pAb

Sign In for Pricing
View Details
METAP1D Rabbit pAb
MBS8559709-05 0.1 mL (AF635)

METAP1D Rabbit pAb

Sign In for Pricing
View Details