CD99L2, Mouse (HEK293, His)
CD99L2 Protein is crucial in aiding leukocytes during a late stage of extravasation by facilitating the overcoming of the endothelial basement membrane barrier. Independently acting at the same site as PECAM1, CD99L2 serves as a homophilic adhesion molecule, even though its interactions may not be essential for cell aggregation. CD99L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD99L2 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD99L2 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd99l2-protein-mouse-hek293-his.html
Purity
97.00
Smiles
DTDGFNLEDALKETSSVKQRWDHFSTTTRRPVTTRAPANPAERWDHVATTTTRRPGTTRAPSNPMELDGFDLEDALDDRNDLDGPKKPSAGEAGGWSDKDLEDIVEGGGYKPDKNKGGGGYGSNDDPGSGISTETGTIA
Molecular Formula
171486 (Gene_ID) Q8BIF0-1 (D26-A164) (Accession)
Molecular Weight
Approximately 24-30 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
HIF-2 alpha Recombinant Antibody, APC-Cy7 Conjugated
CHKB (Choline/Ethanolamine Kinase, Choline/Ethanolamine Kinase beta, CKEKB, Choline Kinase beta, CKB, CK, Choline Kinase-like Protein, Ethanolamine Kinase, Ethanolamine Kinase beta, CHETK, CHKL) (APC)
Lentiviral human OR4C13 shRNA (UAS) - Lentiviral human OR4C13 shRNA (UAS, RFP) (25)
ITPK1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)