Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ω-Hexatoxin-Hv1a

Product Specifications

Synonyms

H-SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD-OH

Controlled

No

More Discoveries

Explore Other Products

Browse additional items from our catalog

Steroid sulfatase Rabbit Polyclonal Antibody (Biotin)
orb458279 100 µL

Steroid sulfatase Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Nori® Rat TNFa ELISA Kit
GR118012 96 Well

Nori® Rat TNFa ELISA Kit

Sign In for Pricing
View Details
CCDC60 Antibody
30-867 100 µL

CCDC60 Antibody

Sign In for Pricing
View Details
RNU2-6P Protein Vector (Human) (pPM-C-His)
PV118477 500 ng

RNU2-6P Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
STXBP3 Polyclonal Conjugated Antibody
C31455 100 µL

STXBP3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
LDB3 (NM_001080116) Human Mass Spec Standard
PH323167 10 µg

LDB3 (NM_001080116) Human Mass Spec Standard

Sign In for Pricing
View Details